DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12236 and CG10959

DIOPT Version :9

Sequence 1:NP_727050.1 Gene:CG12236 / 31523 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:216 Identity:45/216 - (20%)
Similarity:74/216 - (34%) Gaps:51/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 GATPQTSQDATTAAAQNVA--QYSSEY----EILTESEMEEKYQADADNAEIAIEMTRLLGTASG 400
            |...:..|:....:|:.:|  .:..||    ::|:|.|       ||:. |:.:|          
  Fly    77 GRLAREEQEFQGVSAEPLAVDSFKKEYLPNEDVLSEEE-------DAEQ-ELGLE---------- 123

  Fly   401 TPGAGSGQVMEDSG--------GGSATTGPSTTVSVTQVKSDSKASGTNAALKPGSVTVARSSKS 457
                      :|.|        ||..:....|..::.|...||    ::|::..|....|.....
  Fly   124 ----------QDEGNPLRIMVLGGKQSVDEETIDTMWQPDHDS----SSASVNEGCALEALLGVE 174

  Fly   458 GATASAPPA-GSDEESVQYTGLAP--LNCSFCGRPLKSVNALRRHIASRHSEIQGKEHECFICMK 519
            ......|.. |.:.:||......|  .||..|.|...:...|..|:...|...|.  .:|..|..
  Fly   175 NPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQA--FKCVDCKA 237

  Fly   520 SFKTKWSLSTHNSRFHREMGC 540
            :|....:|:.|..:.|.|..|
  Fly   238 TFDVDRALAQHRRKEHTEFAC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12236NP_727050.1 BTB 22..116 CDD:279045
BTB 33..116 CDD:197585
Herpes_capsid <376..467 CDD:283714 16/99 (16%)
C2H2 Zn finger 483..512 CDD:275371 7/28 (25%)
C2H2 Zn finger 514..535 CDD:275371 5/20 (25%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 5/20 (25%)
COG5048 <258..416 CDD:227381 1/1 (100%)
C2H2 Zn finger 258..278 CDD:275368 1/1 (100%)
C2H2 Zn finger 289..308 CDD:275368
C2H2 Zn finger 316..336 CDD:275368
zf-H2C2_2 328..353 CDD:290200
C2H2 Zn finger 344..364 CDD:275368
zf-H2C2_2 357..381 CDD:290200
C2H2 Zn finger 372..392 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.