DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12236 and NACC1

DIOPT Version :9

Sequence 1:NP_727050.1 Gene:CG12236 / 31523 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_443108.1 Gene:NACC1 / 112939 HGNCID:20967 Length:527 Species:Homo sapiens


Alignment Length:242 Identity:68/242 - (28%)
Similarity:101/242 - (41%) Gaps:50/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATTQQYSLRWNNYLRHLTYSLDNHRLNDDFVDVSLCVDGRRIKAHKVVLSSCSSYFKEIFKENP 65
            ||.|.|..:  .|:...:...|:..||...:.|||:.|.|...|||:.||::.||||:::| .|.
Human     1 MAQTLQMEI--PNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLF-NNS 62

  Fly    66 HPHPVIIFKFIKFEDLNSIIEFMYQG--EVNVQQEAL----QSFLQTAELLA------------- 111
            ....|.:...::.:....|:.|.|.|  .:||..:.|    ..|||..|::.             
Human    63 RSAVVELPAAVQPQSFQQILSFCYTGRLSMNVGDQFLLMYTAGFLQIQEIMEKGTEFFLKVSSPS 127

  Fly   112 --VQGLTAEE--KEKPQIPVA------------PLIS-------EHKLIKTIPSTIRAVNEQQQQ 153
              .|||.|||  ..:||.|||            ||:|       |...::.:|...|..:..|::
Human   128 CDSQGLHAEEAPSSEPQSPVAQTSGWPACSTPLPLVSRVKTEQQESDSVQCMPVAKRLWDSGQKE 192

  Fly   154 V---SNVAQAQTATQTIEIPAATLLQATNASQVPSQVVAAAAAAAAA 197
            .   .|.::......|.::.|....|.....|.|  |||||..|.||
Human   193 AGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAP--VVAAAQPAVAA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12236NP_727050.1 BTB 22..116 CDD:279045 33/114 (29%)
BTB 33..116 CDD:197585 30/103 (29%)
Herpes_capsid <376..467 CDD:283714
C2H2 Zn finger 483..512 CDD:275371
C2H2 Zn finger 514..535 CDD:275371
NACC1NP_443108.1 BTB_POZ_BTBD14B_NAC1 3..125 CDD:349599 34/124 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..153 11/21 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..292 12/30 (40%)
BEN 396..474 CDD:214981
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJF0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7738
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.