DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act5C and Actl9

DIOPT Version :9

Sequence 1:NP_001014725.1 Gene:Act5C / 31521 FlyBaseID:FBgn0000042 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_899105.2 Gene:Actl9 / 69481 MGIID:1916731 Length:415 Species:Mus musculus


Alignment Length:375 Identity:154/375 - (41%)
Similarity:241/375 - (64%) Gaps:9/375 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 68
            :..|:|:|.|:|.||.||||...|.....:|:| :|:.|... ...:.::::|:.|:| |..|.|
Mouse    47 KTGAVVIDMGTGTCKVGFAGQSQPTYTVATILGCQPKKQATK-DQSELETFIGEAARS-RPELRL 109

  Fly    69 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 133
            ..||.:|||.:|:..|.||.|...::|:||..|||:|.::.|.:|..||||:.::.||:.::||:
Mouse   110 VKPIRNGIVVDWEAAELIWRHILEHDLQVATHEHPLLFSDPPFSPATNREKLVEVAFESLHSPAL 174

  Fly   134 YVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198
            |||.|:|||:||.||..|:|:|:|.|||:|||:.:||.|||||.||||||..||.:|.::|...|
Mouse   175 YVASQSVLSVYAHGRVNGLVVDTGHGVSYTVPVVQGYNLPHAIQRLDLAGNHLTAFLAEMLLGSG 239

  Fly   199 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALF 263
            :|. ...:.::|.:||...||:|.||::|.  |......::|.:||||:.:|:|.|.|:|||.||
Mouse   240 FSL-QQEDLDLVENIKHHYCYLAPDFQKEQ--ARPDEECKQSLKLPDGRTVTLGKELFQCPELLF 301

  Fly   264 QPSFL-GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT-ALAPSTM 326
            .|..: |:...|:......|::|...::|..:..|.:|.||::::.|:..|.:.|:. :|:|.. 
Mouse   302 HPPEIPGLSPIGLPAMAEQSLLKVPQELRPHVARNVILCGGSSLFTGLEGRFRAELLHSLSPED- 365

  Fly   327 KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
            .:.::|.|.|..||||||||||||..||..|:.:::|:|.||.:|:|||:
Mouse   366 HVVVMAHPNRNLSVWIGGSILASLHAFQSCWVLREQYEERGPQVVYRKCY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act5CNP_001014725.1 PTZ00281 1..376 CDD:173506 153/373 (41%)
Actl9NP_899105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
ACTIN 48..414 CDD:214592 152/371 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.