DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act5C and ACTL6B

DIOPT Version :9

Sequence 1:NP_001014725.1 Gene:Act5C / 31521 FlyBaseID:FBgn0000042 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_057272.1 Gene:ACTL6B / 51412 HGNCID:160 Length:426 Species:Homo sapiens


Alignment Length:428 Identity:158/428 - (36%)
Similarity:228/428 - (53%) Gaps:67/428 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDS------------Y 54
            :||.|||.|.||...:||:||:|.|:|.||:.||  .....|.:...|.|:.            :
Human     9 DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALH 73

  Fly    55 V---GDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN 116
            |   |.|..|         |:::|::.:|:....|..||:...::..|..||||::|||.|.:|.
Human    74 VPRDGAEVMS---------PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAK 129

  Fly   117 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHT--VPIYEGYALPHAILRL 179
            |||:|::|||.:|.||.::...|||:.:|:||:||:||||  |.:||  :|:::||.|...|::.
Human   130 REKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDS--GATHTTAIPVHDGYVLQQGIVKS 192

  Fly   180 DLAGRDLTDYLMKILTERGYSFT---TTAEREIVRD-------IKEKLCYVA------------L 222
            .|||..::....::..|......   ..|.:|.||:       .||||..|:            .
Human   193 PLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQ 257

  Fly   223 DFEQEMATAASSSSLEK--------SYELPDGQVITIGNERFRCPEALFQPS----FLGMEACGI 275
            ||:..:...:.|...|:        .||:|:|.....|.||.|.||.||.||    ..|....|:
Human   258 DFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGV 322

  Fly   276 HETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERK 337
            ......||..||:|||..||.:.:::||.|:..|..||:.:|::...|.:|::|:||   ..|||
Human   323 GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERK 387

  Fly   338 YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 375
            :|.||||||||||.||||||||||||:|.|...|.|||
Human   388 FSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act5CNP_001014725.1 PTZ00281 1..376 CDD:173506 158/428 (37%)
ACTL6BNP_057272.1 Actin 11..426 CDD:394979 157/426 (37%)
Essential for mediating its function in dendritic development, may contribute to neuronal-specific targeting. /evidence=ECO:0000250|UniProtKB:Q99MR0 39..82 8/42 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.