DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16721 and TCP11

DIOPT Version :10

Sequence 1:NP_572275.1 Gene:CG16721 / 31520 FlyBaseID:FBgn0029820 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001357616.1 Gene:TCP11 / 6954 HGNCID:11658 Length:503 Species:Homo sapiens


Alignment Length:88 Identity:21/88 - (23%)
Similarity:36/88 - (40%) Gaps:23/88 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 MLCIQTVIPMITMYFPVAL-FVTLPMFGKDIPYLGNMTSSSLAIYPIIEPIIAMTCVASFRKAIK 334
            ||.:....|.:|...|.:: .||:||      .:.:....||: :||:.|.::.:...|  ..:.
Human   221 MLQVFQPSPSLTPRMPFSIGQVTMPM------VMPSADPRSLS-FPILNPALSQSSQPS--PPLP 276

  Fly   335 GSIRCSVSRSTQFAIHPASSPRL 357
            ||             |..:||.|
Human   277 GS-------------HGRNSPGL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16721NP_572275.1 Tcp11 69..466 CDD:461743 21/88 (24%)
TCP11NP_001357616.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Tcp11 58..487 CDD:461743 21/88 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..285 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.