DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp30 and UBP18

DIOPT Version :9

Sequence 1:NP_001284912.1 Gene:Usp30 / 31519 FlyBaseID:FBgn0029819 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_194895.1 Gene:UBP18 / 829295 AraportID:AT4G31670 Length:631 Species:Arabidopsis thaliana


Alignment Length:367 Identity:81/367 - (22%)
Similarity:130/367 - (35%) Gaps:134/367 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 TSLQRLVRSEAHTPDSPASVCERDGN---------------------DRLGSVLLDAVSPGTPFG 257
            |.::|  .|::..|.||.::..|..|                     |.:.||.||.        
plant   218 THVER--ASQSRFPFSPMNIISRLTNIGGTLGYGRQEDAHEFMRYAIDMMQSVCLDE-------- 272

  Fly   258 FPLVSNPDSLATPMLGGERSSRPRLPQSQQQQDEGLNRRVSSSCRSLERLHRGPGRVSIWSNMMP 322
                          .|||:...||   ||:                                  .
plant   273 --------------FGGEKIVPPR---SQE----------------------------------T 286

  Fly   323 SQVAHPFQGAMGAQIVCNGCGSKSAVRYDKFDSITLNLPPQRRTGLSLGHLLSEYITSEDL---S 384
            :.:.:.|.|.:.:|:.|..|...|    |:::::...:........||...|.::...|.|   :
plant   287 TLIQYIFGGLLQSQVQCTVCNHVS----DQYENMMDLIVEMHGDAGSLEECLDQFTAEEWLHGDN 347

  Fly   385 DVKCDSCNETTTHTKSVTFAKLPACLCIHVARTVWLPTGQVCKRKDYVHFPESLSMAPYSFVQPH 449
            ..|||.|::.....|.:|..:.|..|.|.:.|......|::.||   :.|||:|.:.||      
plant   348 MYKCDRCSDYVKACKRLTIRRAPNILTIALKRYQGGRYGKLNKR---ISFPETLDLNPY------ 403

  Fly   450 LNSQAGTPWGSTMSLYSSSLPMNNGVGGGEGFGTMFPKNLYRLLAVVVHSGEANS---GHFVTYR 511
                        ||            .||:|      .::|:|.||:||....|:   ||::.|.
plant   404 ------------MS------------EGGDG------SDVYKLYAVIVHLDMLNASFFGHYICYI 438

  Fly   512 RGSLRNAHRWYYTSDTIVREVSIDEVLSVPAYLLFYDRGQQR 553
            :....|   ||...|:.:..|.:::|||..||:|.|.|.|.|
plant   439 KDFCGN---WYRIDDSEIESVELEDVLSQRAYMLLYSRIQAR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp30NP_001284912.1 Peptidase_C19 39..>139 CDD:271592
UCH <304..547 CDD:278850 57/248 (23%)
Peptidase_C19F <323..548 CDD:239127 57/230 (25%)
UBP18NP_194895.1 zf-MYND 61..98 CDD:280009
Peptidase_C19E 167..472 CDD:239126 77/360 (21%)
UCH 167..471 CDD:278850 77/359 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.