DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp30 and UBP20

DIOPT Version :9

Sequence 1:NP_001284912.1 Gene:Usp30 / 31519 FlyBaseID:FBgn0029819 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_567544.1 Gene:UBP20 / 827513 AraportID:AT4G17895 Length:695 Species:Arabidopsis thaliana


Alignment Length:415 Identity:94/415 - (22%)
Similarity:147/415 - (35%) Gaps:96/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SDALPTDNDDNSSLAGTATPVGGFRSFSSMAAGLGAS-QRIGDQPNRPSSAMLTDFLNMEYDEST 214
            ||....::||||......:...|||.......|:||. ..:|:          :.|||..:...|
plant   141 SDDDDDNDDDNSKNEPRKSLFYGFRQEPEPVTGVGAGLWNLGN----------SCFLNSVFQCFT 195

  Fly   215 SLQRLVRSEAHTPDSPASVCERDGND----------RLGSVLLDAVSPGTPFGFPLVSNPDSLAT 269
            ....|:.|...........|   ||:          .:.:.|.....|..|:.|  ..|.:..: 
plant   196 HTVPLIESLLSFRYEVPCHC---GNEFFCVIRAIRYHIEAALRPERCPIAPYFF--FDNLNYFS- 254

  Fly   270 PMLGGERSSRPRLPQSQQQQDEGLNRRVSSSCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMG 334
                         |..|:.|.|..:..:.:....||..  |..|.|...::....|   |.|.:.
plant   255 -------------PDFQRYQQEDAHEFLQAFLEKLEIC--GSDRTSFRGDITSQDV---FSGRLI 301

  Fly   335 AQIVCNGCGSKSAVRYDKFDSITLNLPPQRRTGLSLGHLLSEYITSEDLSD-VKCDSCNETTTHT 398
            :.:.|..|...|.. |:|...::|.:....    :||..|..:...|.|.: :.||:|||..:..
plant   302 SGLRCCNCDYVSET-YEKSVGLSLEIEDVD----TLGSALESFTRVEKLDEQLTCDNCNEKVSKE 361

  Fly   399 KSVTFAKLPACLCIHVARTVWLPTGQVCKRKDYVH--FPESLSMAPYSFVQPHLNSQAGTPWGST 461
            |.:...|||.....|:.|   .....:...|.|.|  .|..:.:.||.     .|.|        
plant   362 KQLLLDKLPLVATFHLKR---FKNNGLYMEKIYKHVKIPLEIDLQPYM-----RNIQ-------- 410

  Fly   462 MSLYSSSLPMNNGVGGGEGFGTMFPKNLYRLLAVVVHSGEANS-GHFVTYRRGSLRNAHR-WYYT 524
                      .|.|           ...|.|.|:|.|.|.:.: ||:.:|    :|:|.: |::.
plant   411 ----------ENEV-----------STKYHLYALVEHFGYSVAYGHYSSY----VRSAPKIWHHF 450

  Fly   525 SDTIVREVSIDEVLSVPAYLLFYDR 549
            .|:.|..:..|.|||..:|:|||.|
plant   451 DDSKVTRIDEDMVLSQDSYILFYAR 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp30NP_001284912.1 Peptidase_C19 39..>139 CDD:271592
UCH <304..547 CDD:278850 60/247 (24%)
Peptidase_C19F <323..548 CDD:239127 56/229 (24%)
UBP20NP_567544.1 Peptidase_C19E 175..474 CDD:239126 82/378 (22%)
UCH 176..473 CDD:278850 80/376 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.