DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp30 and UBP19

DIOPT Version :9

Sequence 1:NP_001284912.1 Gene:Usp30 / 31519 FlyBaseID:FBgn0029819 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_565576.1 Gene:UBP19 / 817000 AraportID:AT2G24640 Length:672 Species:Arabidopsis thaliana


Alignment Length:529 Identity:101/529 - (19%)
Similarity:163/529 - (30%) Gaps:225/529 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GLHNFGLTCFLNTLLQAMAACPQFIAWLQLYNNASPDRKS---LITSMLNTLEVVNGTHATLRGD 101
            ||.|.|.:||.|.:||.::.....:|:|....:....|::   .:....|.|:..|.:..     
plant   175 GLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRRNDWCFLCEFENHLDRANYSRF----- 234

  Fly   102 PYSPGAVLRALNALGWVIPQ-EEHDAHELFHVLLTCLEEEAIRPQPLGCLSDALPTDNDDNSSLA 165
            |:||..::..|..:|..:.. .:.|||||....:                               
plant   235 PFSPMNIISRLPNIGGNLGYGRQEDAHELMRFAI------------------------------- 268

  Fly   166 GTATPVGGFRSFSSMAAGLGASQRIGDQPNRPSSAMLTDFLNMEYDESTSLQRLVRSEAHTPDSP 230
                                                                             
plant   269 ----------------------------------------------------------------- 268

  Fly   231 ASVCERDGNDRLGSVLLDAVSPGTPFGFPLVSNPDSLATPMLGGERSSRPRLPQSQQQQDEGLNR 295
                     |.:.||.||.                      .|||:...||..::          
plant   269 ---------DMMQSVCLDE----------------------FGGEKVVPPRAQET---------- 292

  Fly   296 RVSSSCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRYDKFDSITLNL 360
                                       :.:.:.|.|.:.:|:.|..|.:.|. :|:....:|:.:
plant   293 ---------------------------TLIQYIFGGLLQSQVQCTACSNVSD-QYENMMDLTVEI 329

  Fly   361 PPQRRTGLSLGHLLSEYITSEDLSD---VKCDSCNETTTHTKSVTFAKLPACLCIHVARTVWLPT 422
               ....:||...|.::...|.|..   .|||.|::.....|.::....|..|.|.:.|......
plant   330 ---HGDAVSLEECLDQFTAKEWLQGDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQGGRF 391

  Fly   423 GQVCKRKDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLPMNNGVGGGEGFGTMFPK 487
            |::.||   :.|||:..:.||                  ||            |||||      .
plant   392 GKLNKR---ISFPETFDLGPY------------------MS------------GGGEG------S 417

  Fly   488 NLYRLLAVVVHSGEANS---GHFVTYRRGSLRNAHRWYYTSDTIVREVSIDEVLSVPAYLLFYDR 549
            ::|:|.||:||....|:   ||::.|.:....|   ||...|:.|.:|.:::|||..||:|.|.|
plant   418 DVYKLYAVIVHLDMLNASFFGHYICYVKDFRGN---WYRIDDSEVEKVELEDVLSQRAYMLLYSR 479

  Fly   550 GQQRQLNLR 558
            .|.|..|||
plant   480 VQPRPSNLR 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp30NP_001284912.1 Peptidase_C19 39..>139 CDD:271592 25/102 (25%)
UCH <304..547 CDD:278850 59/248 (24%)
Peptidase_C19F <323..548 CDD:239127 59/230 (26%)
UBP19NP_565576.1 zf-MYND 64..101 CDD:280009
Peptidase_C19E 173..478 CDD:239126 94/517 (18%)
UCH 173..477 CDD:278850 94/516 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.