DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp30 and USP27X

DIOPT Version :9

Sequence 1:NP_001284912.1 Gene:Usp30 / 31519 FlyBaseID:FBgn0029819 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001138545.1 Gene:USP27X / 389856 HGNCID:13486 Length:438 Species:Homo sapiens


Alignment Length:429 Identity:101/429 - (23%)
Similarity:145/429 - (33%) Gaps:130/429 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RSFSSMAAGLGASQRIGDQPNRPSSAMLTDFLNMEYDESTSLQRLVRSEAHTPD------SPASV 233
            |..||...||.....:|:          |.|:|.          :|::..|||.      |....
Human    68 RITSSFTIGLRGLINLGN----------TCFMNC----------IVQALTHTPILRDFFLSDRHR 112

  Fly   234 CERDGNDRLGSVLLDAVSPGTPFGFPLVSNPDSLATPMLGGERSSRPRLPQS------------- 285
            ||....:                 ..||....||...:..|..|  |.:|..             
Human   113 CEMPSPE-----------------LCLVCEMSSLFRELYSGNPS--PHVPYKLLHLVWIHARHLA 158

  Fly   286 ---QQQQDEGLNRRVSSSCRSLERLHR-----GPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGC 342
               ||...|.|       ..:|:.|||     ..|:.:...|.....:...|.|.:.:.:.|..|
Human   159 GYRQQDAHEFL-------IAALDVLHRHCKGDDVGKAANNPNHCNCIIDQIFTGGLQSDVTCQAC 216

  Fly   343 GSKSAVRYDKFDSITLNLP----------PQRRTGL----------SLGHLLSEYITSEDL---S 384
            ...|.. .|....|:|:||          |.|.:.:          :|...|..:...|.|   :
Human   217 HGVSTT-IDPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSA 280

  Fly   385 DVKCDSCNETTTHTKSVTFAKLPACLCIHVARTVWLPTGQVCKRK--DYVHFPESLSMAPY--SF 445
            .:||.||......||.:|..|||...|.|..|   .......:||  .|:.||..|.|.|:  |.
Human   281 KIKCGSCQSYQESTKQLTMNKLPVVACFHFKR---FEHSAKQRRKITTYISFPLELDMTPFMASS 342

  Fly   446 VQPHLNSQAGTPWGSTMSLYSSSLPMNNGVGGGEGFGTMFPKNLYRLLAVVVHSGEANSGHFVTY 510
            .:..:|.|.             .||.|:|..          :|.|.|.|||.|.|...|||:.::
Human   343 KESRMNGQL-------------QLPTNSGNN----------ENKYSLFAVVNHQGTLESGHYTSF 384

  Fly   511 RRGSLRNAHRWYYTSDTIVREVSIDEVLSVPAYLLFYDR 549
            .|   .:..:|:...|.::.:.||.:||....|||||.:
Human   385 IR---HHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp30NP_001284912.1 Peptidase_C19 39..>139 CDD:271592
UCH <304..547 CDD:278850 71/274 (26%)
Peptidase_C19F <323..548 CDD:239127 66/251 (26%)
USP27XNP_001138545.1 Peptidase_C19D 78..419 CDD:239125 95/416 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.