DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mof and kat7a

DIOPT Version :9

Sequence 1:NP_511051.1 Gene:mof / 31518 FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001070052.1 Gene:kat7a / 767644 ZFINID:ZDB-GENE-060929-168 Length:128 Species:Danio rerio


Alignment Length:104 Identity:24/104 - (23%)
Similarity:41/104 - (39%) Gaps:11/104 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SASLDVSGSDQSAEQSLDLSGVQAEAA-----AESEPPAKRQHRDISPISEDSTPASSTSTS-ST 110
            |:|.....||.|||.: |.|..:|...     ..|.....|..:|.||:...:.|.|....: ||
Zfish    10 SSSEGTEDSDFSAEHT-DSSESEAHVVRNTRLTRSSLRLSRSSQDASPVRNPTAPVSEEVVNYST 73

  Fly   111 RSSSSSRYDDVSEAEEAPPEPEPEQPQQQQQEEKKEDGQ 149
            |..:.|:    .:.....|:..|.:..:....:.::.|:
Zfish    74 RRVTRSQ----QQGATVSPKKYPLRQSRSSGSDTEQHGE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553
NAT_SF 528..813 CDD:302625
MOZ_SAS 599..778 CDD:280097
kat7aNP_001070052.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.