DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mof and trim69.1

DIOPT Version :9

Sequence 1:NP_511051.1 Gene:mof / 31518 FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:XP_002937994.2 Gene:trim69.1 / 100487155 XenbaseID:XB-GENE-6462279 Length:644 Species:Xenopus tropicalis


Alignment Length:146 Identity:38/146 - (26%)
Similarity:68/146 - (46%) Gaps:19/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 EEEDEDDALTMEHDNTSRETVITTGDPLMQKIDISE--------NPDKIYFIRREDGTVHRGQVL 398
            |.|.::|.:..|.|:...::  |.||.....:::..        |....|..::.||::|..:|:
 Frog     8 EPEKKEDMVCEEADSNQEDS--TAGDEADGSVNVQNKAEEDEAVNVGSTYQCKKADGSLHDAEVV 70

  Fly   399 QSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLA 463
            ::|..:. ...:||||||:|||||.:.||.:.|:.        :|...|...|.|:.|.:.:.:.
 Frog    71 KTRINKQ-LGKEEYYVHYIGLNRRQNEWVDKTRLV--------LTKAEAKEEAKDEASGNDQEIT 126

  Fly   464 QQAAAAAAASSERQKR 479
            .....|...:.:.|||
 Frog   127 DAVEPANGKTPQGQKR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 19/49 (39%)
NAT_SF 528..813 CDD:302625
MOZ_SAS 599..778 CDD:280097
trim69.1XP_002937994.2 PLN00104 20..>150 CDD:215056 34/134 (25%)
CD_CSD 52..>107 CDD:421697 20/63 (32%)
RING_Ubox 177..220 CDD:418438
Bbox2_xNF7-like 257..295 CDD:380858
BBC 305..422 CDD:128778
SPRY_PRY_C-I_1 472..641 CDD:293968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10465
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.