DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12729 and AT1G48530

DIOPT Version :9

Sequence 1:NP_572271.1 Gene:CG12729 / 31515 FlyBaseID:FBgn0029816 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_175286.2 Gene:AT1G48530 / 841274 AraportID:AT1G48530 Length:175 Species:Arabidopsis thaliana


Alignment Length:160 Identity:28/160 - (17%)
Similarity:62/160 - (38%) Gaps:17/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KSETEIDAHDWQLLLHSIQSHIRKKSDLL-------IAVTHFLITKEYRLRCAINYSASDGRQLA 90
            ::|:....|....::.|:....|.|:|.:       :||:.|::|...|...|.:..:|...|..
plant     8 QTESMATTHAVMGVIRSVMPAFRNKNDKIAFVVHASLAVSGFILTSTGRPAFAHDALSSSTTQCL 72

  Fly    91 GGCGTVCEQLPDHWNRDADRYTLNYTDGLAGQYILMAKLSRRDLVISLQNSTSKRMAIVCLQPEH 155
            .|.        :.||...:.|...|...:. :|::........|::.......|....:.::..:
plant    73 VGI--------EGWNEFDEEYAFVYKCPVK-RYLVKCLAMNDKLLVDAIAEDGKEFGHLQIEVGN 128

  Fly   156 LVN-STCKSSMDKCIPRLDKFIKRLRAELV 184
            .:: |..:...|......||.:..|::|::
plant   129 YIDESGEEGDYDTQFKNFDKLVTELKSEIL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12729NP_572271.1 PI31_Prot_N 50..193 CDD:288423 25/143 (17%)
AT1G48530NP_175286.2 PI31_Prot_N 27..161 CDD:288423 25/141 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1614691at2759
OrthoFinder 1 1.000 - - FOG0005143
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.