DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12729 and Psmf1

DIOPT Version :9

Sequence 1:NP_572271.1 Gene:CG12729 / 31515 FlyBaseID:FBgn0029816 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001094475.1 Gene:Psmf1 / 689852 RGDID:1587528 Length:271 Species:Rattus norvegicus


Alignment Length:170 Identity:37/170 - (21%)
Similarity:70/170 - (41%) Gaps:18/170 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DLLIAVTHF-LITKEYRLRCAINYSASDGRQLAGGCGTVCEQLPDHWNRDADRYTLNY--TDGLA 120
            |.|:...|: ::|..|       |....|.| ........|.||..||.:.:.|.|.|  .|| |
  Rat    20 DALVCFLHWEVVTNGY-------YGLGTGDQ-PDPNDKKSELLPAEWNSNKELYALRYESKDG-A 75

  Fly   121 GQYILMAKLSRRDLVISLQNSTSKRMAIVCLQPEHLVNSTCKSSMDKCIPRLDKFIKRLRAELVD 185
            .:.:|.|......::|::....::::|.:.|..:..:::...|...:.....::...|:|:.::.
  Rat    76 RKLLLKAVSVENGMIINVLEHGTQQVADLTLNLDDYIDAEDLSDFHRTYKNSEELRSRIRSGIIT 140

  Fly   186 P------AVRGTKRLAEIGPAFNRKIWKRELPVRNSGTSR 219
            |      .||.:....|..||..|::....:...:..|||
  Rat   141 PIHEQWEKVRLSSPPREFPPATAREVDPLRISSHHPHTSR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12729NP_572271.1 PI31_Prot_N 50..193 CDD:288423 30/142 (21%)
Psmf1NP_001094475.1 Important for homodimerization and interaction with FBXO7. /evidence=ECO:0000250 2..150 28/138 (20%)
PI31_Prot_N 11..148 CDD:288423 28/136 (21%)
PI31_Prot_C 182..248 CDD:285745
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350575
Domainoid 1 1.000 45 1.000 Domainoid score I11876
eggNOG 1 0.900 - - E1_KOG4761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1614691at2759
OrthoFinder 1 1.000 - - FOG0005143
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.