DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgmNAT and AANATL6

DIOPT Version :9

Sequence 1:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_611405.2 Gene:AANATL6 / 37212 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster


Alignment Length:211 Identity:57/211 - (27%)
Similarity:99/211 - (46%) Gaps:8/211 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DDIVVRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPP----EPEAADKEFLLSNVPFGTCFVALH 67
            |.|.||.:...:..::.||:..:::.:||:..|...|    ..|..|::: |:.:..|...|||.
  Fly     7 DGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQY-LAVIRQGLSIVALD 70

  Fly    68 E---GRIVAAVVAGPKDSHEPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRFSVPSCLHVH 129
            :   |.:|...||...|..|.....:||.:......|.....::.||...::..||.|.|.|.:.
  Fly    71 DNNGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSSYLSLL 135

  Fly   130 ALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQRLGYQLINTLRYVDHLDA 194
            .:.|.|.:|.|.:...|.:.:.:.||..||.|.....|:.||:|...:.|.:.|:::.|.|:.|.
  Fly   136 VISVHPSMRQRGILVILSKCLFKLGRLRGHTLFITSGTNHYSSRSAMKAGCECIHSVAYADYKDE 200

  Fly   195 SGQQVIRPPPPHESVQ 210
            .|:.:..||.||..::
  Fly   201 LGRPIYNPPAPHTHIR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 41/153 (27%)
AANATL6NP_611405.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435017
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100876at33392
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 1 1.000 - - mtm9663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.