DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgmNAT and R05H10.7

DIOPT Version :9

Sequence 1:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001022271.1 Gene:R05H10.7 / 3565038 WormBaseID:WBGene00011046 Length:226 Species:Caenorhabditis elegans


Alignment Length:213 Identity:43/213 - (20%)
Similarity:88/213 - (41%) Gaps:29/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DDIVVRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPPEPEAADKEFLLSNV-------PFGTCFV 64
            ::::.|.....:...::.|||.||:|.||.|......:.||   |.|..::       ||.| .|
 Worm     3 EELIYRLAKKSDAPDVLNFLLEHYFPLEPCTRALKLIKSEA---EVLYESLVARCLQFPFST-VV 63

  Fly    65 ALHEGRIVAAVV--AGPKDSHEPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRR-------F 120
            ....|.|||.:|  |..:|.:..|....|..:       .:...::|.....:.|..       .
 Worm    64 TTQSGEIVACLVNSAWKRDDNAVEGADYEVDE-------GLTENMTAFIKMLNTCHEDFWNLAPQ 121

  Fly   121 SVPSCLHVHALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSV--DCTSVYSARLVQRLGYQLI 183
            ::...||.....|..:.:.|.:..:::.|...:.:...:.:..|  :..|..:..|:::.|::.:
 Worm   122 NINVVLHREVSSVSEKYQRRGIATKMLTTNMPKAKLDEYSIDGVLSETCSFGNQVLLEKHGFKCL 186

  Fly   184 NTLRYVDHLDASGQQVIR 201
            .|:.|...:|:.|.|:::
 Worm   187 KTIPYTGIVDSQGNQILK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 30/164 (18%)
R05H10.7NP_001022271.1 Acetyltransf_7 <134..184 CDD:316066 7/49 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.