DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgmNAT and AANATL2

DIOPT Version :9

Sequence 1:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster


Alignment Length:215 Identity:64/215 - (29%)
Similarity:105/215 - (48%) Gaps:9/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVVRQVDVGETEQLMTFLLAHYYPEEP--LTAGTHPPEPE--AADKEFLLSNVPFGTCFVALHEG 69
            |.:|.:.:|:.|::..||..|::.:||  |.....|.:.|  :|:.|...|.:|.....||:...
  Fly     4 ITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVAVDGE 68

  Fly    70 RIVAAVVAG---PKDSHEPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRFSVPSCLHVHAL 131
            |||..|:||   |:|.......||:  |........|...|:.:|...::.:.:.|...|:::.|
  Fly    69 RIVGVVLAGELVPEDLEREYQEAEQ--KEITCLLDKIHKFLAGIERQANIFKHYGVERALYLYML 131

  Fly   132 GVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQRLGYQLINTLRYVDHLDASG 196
            |||..:|.:.:|.||:|...:.||..|..:|:..|::..|.||:..|..:.|.|..|.|:.|..|
  Fly   132 GVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHG 196

  Fly   197 QQVIRPPPPHESVQTFVLHL 216
            :.|:|...||.|.....:.|
  Fly   197 EIVLRASEPHTSASVVAIRL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 45/153 (29%)
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435018
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I7474
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108272at50557
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 1 1.000 - - mtm9663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.