DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgmNAT and CG31493

DIOPT Version :9

Sequence 1:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_731135.2 Gene:CG31493 / 318765 FlyBaseID:FBgn0051493 Length:246 Species:Drosophila melanogaster


Alignment Length:138 Identity:32/138 - (23%)
Similarity:50/138 - (36%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GTCFVALH--EGRIVAA---VVAGPKDSHEPEHMAEEAR-----KYAGGKWGSILHLLSAVETAT 114
            |..|...|  .||||||   ::...|.......:..:.:     ||        :.|..||:.:.
  Fly    66 GISFAIRHVESGRIVAAIANIIFNTKRKTSYYDICAQIKSPNMIKY--------MELWDAVDASF 122

  Fly   115 DVCRRFSVPSCLHVHALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQR-L 178
            :|.....|.|...|..:...|:.|.|.||..|.:...|                 :::.|.|| |
  Fly   123 NVNEHCQVDSTGDVEYMATLPEFRRRGLGHILCQQSIQ-----------------FASLLAQRKL 170

  Fly   179 GYQLINTL 186
            ..:::|.|
  Fly   171 PLEILNQL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 30/130 (23%)
CG31493NP_731135.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.