DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgmNAT and W02D7.4

DIOPT Version :9

Sequence 1:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_505142.1 Gene:W02D7.4 / 189116 WormBaseID:WBGene00020940 Length:232 Species:Caenorhabditis elegans


Alignment Length:218 Identity:46/218 - (21%)
Similarity:82/218 - (37%) Gaps:45/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVVRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPPEPEAADKEFLLS-----NVPFGTCFVALHE 68
            ::.|.....:.|:::.||..|:..|||.:... ...||.:...|..:     ..||.|  |.|.|
 Worm    12 LLFRVAQPKDHERIIKFLDKHFAKEEPCSRAL-KISPEISRGVFTATVTRCLTTPFST--VVLQE 73

  Fly    69 -GRIVAAVVAGPKDSHEPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRFSVPSCLHVHALG 132
             |.:.|.::|...:..:|...|:.........:...:..|:............:|.|.:|.....
 Worm    74 NGDLAACLLASVWNRTDPLENADFDDTGLPENFKLFIQFLNKAHLNFWKIAPPNVNSIIHREIGS 138

  Fly   133 VDPQ-------------------LRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQRL 178
            |.||                   |:..|:||.|.||.:     |.:|:|            :::.
 Worm   139 VAPQFTRLGIATKMVTTNMTKRNLKKYNIGGVLSETTS-----LANQIV------------LEKA 186

  Fly   179 GYQLINTLRYVDHLDASGQQVIR 201
            |::.:..|.|...:|:.|.||::
 Worm   187 GFKCLKELPYSTIVDSKGNQVLK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 34/171 (20%)
W02D7.4NP_505142.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.