DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgmNAT and M7.12

DIOPT Version :9

Sequence 1:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_502070.2 Gene:M7.12 / 187458 WormBaseID:WBGene00010887 Length:241 Species:Caenorhabditis elegans


Alignment Length:209 Identity:37/209 - (17%)
Similarity:80/209 - (38%) Gaps:49/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QLMTFLLAHYYPEEPLTAGTHPPEPEAADKEFLLSNVPFGTCFVALHEGRIV---AAVVAGPKDS 82
            :::.||..::..||||:......|.:            ..:||..:.| |::   .:::|..|.|
 Worm    36 EVVDFLNNNFRVEEPLSKAAGMTESD------------IQSCFDGVFE-RVLKNEVSILARSKQS 87

  Fly    83 HE--------------PEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRF-----SVPSCLHV 128
            .|              |:...:||..:..|  |....:::..|...::...|     ...:.||.
 Worm    88 DEIVGCMLNSVWKRNDPKKNEDEAEDFEFG--GDRKGVMTIGEILNELHESFWKLRPDQHTVLHF 150

  Fly   129 HALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSAR-------LVQRLGYQLINTL 186
            ....|:...:.:.|..:.|....::     ..|.||:.:|:.:..       |:.:.||:.:.:.
 Worm   151 EISSVNKNHQRQGLASKFMNWTEKK-----ELLKSVEASSIVAEASSLANQILLSKRGYETVAST 210

  Fly   187 RYVDHLDASGQQVI 200
            .....:|.:|:|::
 Worm   211 LLSSRIDVNGKQIL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 30/175 (17%)
M7.12NP_502070.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.