DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgmNAT and T10B5.4

DIOPT Version :9

Sequence 1:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001300192.1 Gene:T10B5.4 / 178668 WormBaseID:WBGene00020390 Length:237 Species:Caenorhabditis elegans


Alignment Length:192 Identity:36/192 - (18%)
Similarity:71/192 - (36%) Gaps:38/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EQLMTFLLAHYYPEEPLTAGTHPPEPEAAD--KEFLLSNVPFGTCFVALHEGRIVAAVV------ 76
            :|:..||:.|:...||:|......|.:.|:  .:..:|.:......:.:.:|..:.||.      
 Worm    15 DQVHKFLVEHFRVMEPITTSLSCSEEDVAEFFVDLTMSGLEDEKSSILVFDGEEIVAVCLNAVKE 79

  Fly    77 ------AGPKDSH--------EPEHMAEEARKYAGGKWGSILHLLSAVET-ATDVCRRFSVP-SC 125
                  :.|.:.|        ..::..|.|.|           |::.|:. ..|:......| ..
 Worm    80 CSFVSESTPFNPHWDFNAEITNGQYKHENANK-----------LVAFVQVLEQDLSFLTGNPKKV 133

  Fly   126 LHVHALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQRLGYQLINTLR 187
            ..:..|.|....:|:.:|.:|:|...:.......:.|:...|:|.|..:..:.|   :.|||
 Worm   134 FKIDVLCVSKACQGKGIGRQLVEKSLENAVKEDCEYVATVATAVASQNIFSKCG---LTTLR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 28/170 (16%)
T10B5.4NP_001300192.1 Acetyltransf_1 <110..187 CDD:366181 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.