DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgmNAT and anat-1

DIOPT Version :9

Sequence 1:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001076662.1 Gene:anat-1 / 177439 WormBaseID:WBGene00015938 Length:285 Species:Caenorhabditis elegans


Alignment Length:240 Identity:51/240 - (21%)
Similarity:80/240 - (33%) Gaps:68/240 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPPEPEAADKEFLL--------SNVPFGTCFVALH 67
            |..|.....|:::.||:.::...|.:.|.....:.:...||..:        |.....||.:...
 Worm    65 VESVKESNLEEIVQFLIDNFAQTEAILASLKIDDDKICLKELTVMLRDLVQDSLQCSSTCVIRDV 129

  Fly    68 EGRIVAAVVAGPK----DSHEPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRFSVPSCLHV 128
            ..|.:..:....|    |.......|.|.|:.         .:..|||....|..:..|...|:.
 Worm   130 TTRQIDGIALACKTSIFDKQIDRLCAYEFREQ---------RVRDAVEFLKYVFNKLDVMYYLNE 185

  Fly   129 HAL---------GVDPQLRGRNLGGRLMETVAQRGR-------------DLGHQLVSVDCTSVYS 171
            |.|         .|..:|.||.:|..||..|....|             :.||:|:...|.:.::
 Worm   186 HRLYKPVFVALVCVRKELWGRGIGTTLMNHVKSAARTDSSDGLISLCSNERGHKLMKTYCPTDFA 250

  Fly   172 ARLVQRLGYQLINTLRYVDHLDASGQQVIRPP----PPHESVQTF 212
            |             :||    ||...:.:|||    ||    :||
 Worm   251 A-------------VRY----DAFKGEHLRPPIVMRPP----ETF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 35/180 (19%)
anat-1NP_001076662.1 NAT_SF <192..221 CDD:173926 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.