DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgmNAT and R05H10.1

DIOPT Version :9

Sequence 1:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_497076.1 Gene:R05H10.1 / 175144 WormBaseID:WBGene00011042 Length:250 Species:Caenorhabditis elegans


Alignment Length:226 Identity:40/226 - (17%)
Similarity:88/226 - (38%) Gaps:49/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IADDIVVRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPPEPEAADKEFL---------LSNVPFG 60
            ::.:.:.|..:..:.::::.||..|:|.|||....:     :.|.:|:|         ...:|..
 Worm     1 MSSNYIYRTAEKSDFDRILKFLAEHFYHEEPSIRAS-----KIALEEWLPIFGEMTTSSLKLPIS 60

  Fly    61 TCFVALHEGRIVAAVVAGPKDSHEPEHMAEEARKYAGGKWG--------SILHLLSAVETATDVC 117
            | .|...:|..:.||:.....|.|.:   ||..|:..||..        ::...::.|:...|..
 Worm    61 T-VVTTEDGENIVAVLLNSMWSREED---EERMKHGNGKGDHDTSGYSEALQRFMTIVQKCHDEF 121

  Fly   118 RRFSVPSCLHV-------------HALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSV 169
            ...: ||.:::             ...|:..::..||:....:..|        ..:||. .:|.
 Worm   122 WNLA-PSDVNLVVYREISSVGKPWQRQGIATKMLSRNMSAARLHNV--------DGIVSA-TSSF 176

  Fly   170 YSARLVQRLGYQLINTLRYVDHLDASGQQVI 200
            .:..|:.:.|:|.:....|...:.::|.:::
 Worm   177 ANQTLLAKNGFQCLKEFPYSGIVSSNGDKLV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 31/176 (18%)
R05H10.1NP_497076.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.