DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Psmb1

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_446042.1 Gene:Psmb1 / 94198 RGDID:621092 Length:240 Species:Rattus norvegicus


Alignment Length:217 Identity:49/217 - (22%)
Similarity:99/217 - (45%) Gaps:23/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PKAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLT 106
            |.|...|| ::.|..:|..|:.:|||.:||..:..::..|.:.|.|......:|...|...:|..
  Rat    31 PYAFNGGT-VLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKI 94

  Fly   107 TSAELDLHRLN-----TERRVPVVCASMMLRRTLFRYQGHIGAALVMGGVDTTGP-QLYCIYPCG 165
            ..|.|.:::.:     |...:..:.::::..|..|.|..:    .::.|:|..|. .:|...|.|
  Rat    95 IEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVY----NIIEGLDEEGKGAVYSFDPVG 155

  Fly   166 SNDKIPYAAMGSGTLAAMSVLEH--GWK-------PDLDLEQGKQLVREAISAGVFNDLGSGSNI 221
            |..:..:.|.||.:.....:|::  |:|       ..|.|::..:||::...:....|:.:|..:
  Rat   156 SYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDAL 220

  Fly   222 DLCVITAKGAVYLRTDTIASEK 243
            .:|::|.:|   :|.:|:...|
  Rat   221 RICIVTKEG---IREETVPLRK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 46/207 (22%)
proteasome_beta_type_7 49..236 CDD:239732 43/201 (21%)
Pr_beta_C 241..274 CDD:289249 1/3 (33%)
Psmb1NP_446042.1 proteasome_beta_type_1 29..240 CDD:239726 49/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.