DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PRE2

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:249 Identity:68/249 - (27%)
Similarity:108/249 - (43%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NTSADFVGLRSGFNFINCRRNAELLSKGYEPPKA---------------------IKTGTSIVGI 54
            |..:|||...|.|     :|.|..|:   .||.|                     |..||:.:..
Yeast    25 NLESDFVTGASQF-----QRLAPSLT---VPPIASPQQFLRAHTDDSRNPDCKIKIAHGTTTLAF 81

  Fly    55 IYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTE 119
            .::.|:|:..|:|||.|..|:.:...|:..:...:....||.|||.:.......::..||.|..:
Yeast    82 RFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREK 146

  Fly   120 RRVPVVCASMMLRRTLFRYQGHIGAALVMGGV-----DTTGPQLYCIYPCGSNDKIPYAAMGSGT 179
            .|:.|..||.:|...:::|:   ||.|.||.:     ...||.:|.:...|:..|.....:|||.
Yeast   147 ERISVAAASKILSNLVYQYK---GAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQ 208

  Fly   180 LAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKGAVY 233
            ..|..||:..:|.||.:|....|.:.:|.|....|..||.:::|..:|..|.:|
Yeast   209 TFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 55/191 (29%)
proteasome_beta_type_7 49..236 CDD:239732 54/190 (28%)
Pr_beta_C 241..274 CDD:289249
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 54/190 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.