DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PRE5

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_014045.1 Gene:PRE5 / 855362 SGDID:S000004931 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:49/228 - (21%)
Similarity:89/228 - (39%) Gaps:41/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCG-------AGTAADT 100
            :|||.|:..||:......:|          :...:|..::...|..|..|.       ||.|.|.
Yeast    27 EAIKQGSVTVGLRSNTHAVL----------VALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDA 81

  Fly   101 EMITLTTSAELDLHRLNTERRVPVVCASMML----RRTLFRYQGH-IGAALVMGGVDTTGPQLYC 160
            .:::.....:.:...|...|::.|..|..:|    ::....|.|. .|..|::.|.|.:|..|..
Yeast    82 RVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLE 146

  Fly   161 IYPCGSNDKIPYAAMGSGTLAAMSVLEH--------GWKPDLDLEQGKQLVREAISAGVFNDLGS 217
            ..|.|:..::...|:|:.:..|.:.||.        ...||..::.|.    ||||..:.::..:
Yeast   147 FQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGV----EAISQSLRDESLT 207

  Fly   218 GSNIDLCVITAKGAVYLRTDTIASEKGERLGKY 250
            ..|:.:.:: .|...:...|      ||.:.||
Yeast   208 VDNLSIAIV-GKDTPFTIYD------GEAVAKY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 42/212 (20%)
proteasome_beta_type_7 49..236 CDD:239732 40/206 (19%)
Pr_beta_C 241..274 CDD:289249 4/10 (40%)
PRE5NP_014045.1 Ntn_hydrolase 6..217 CDD:412394 43/204 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.