DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and psma6l

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_571870.2 Gene:psma6l / 83917 ZFINID:ZDB-GENE-010502-2 Length:252 Species:Danio rerio


Alignment Length:256 Identity:48/256 - (18%)
Similarity:93/256 - (36%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GLRSGFNFINCRRNAELLS---KGYEPPKAIK----TGTSIVGIIYKDGVILGADTRATEGPIVS 75
            |..:||:     |:..:.|   :.|:...|.|    :|.:.|||...|..:|....:.:: .::.
Zfish     4 GSNAGFD-----RHITIFSPEGRLYQVEYAFKAISQSGLTTVGIRGVDCAVLVTQKKVSD-TLLD 62

  Fly    76 DKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTER---------RVPV--VCASM 129
            ....:.:..:...|.|...|..||:..         .:||...|.         .|||  :|..:
Zfish    63 ASTMTNMFRITPRIGCVMTGHYADSRS---------QVHRARIEAGEWKYKFGYDVPVDALCRRL 118

  Fly   130 MLRRTLFRYQGH---IGAALVMGGVD-TTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGW 190
            .....::.....   :|..:::..:| ..||.||...|.|........::|.....|.|.||...
Zfish   119 ADLSQVYTQNAEMRPLGCCMMLISMDPQKGPMLYKCDPAGYFCGFRATSVGVKHTEANSYLEKKI 183

  Fly   191 KP--------DLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKGAVYLRTDTIASEK 243
            |.        :||.:...|:....:|:.:..|. ..:.:::.|:|.:...:.....:..|:
Zfish   184 KKMQKKKEEVELDFDSSVQMAISCLSSVLCMDF-KCTELEVAVVTKENPKFRTLSEVEIER 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 39/215 (18%)
proteasome_beta_type_7 49..236 CDD:239732 38/209 (18%)
Pr_beta_C 241..274 CDD:289249 1/3 (33%)
psma6lNP_571870.2 PRE1 7..252 CDD:223711 47/253 (19%)
proteasome_alpha_type_6 8..226 CDD:239723 44/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.