DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PBE1

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001184978.1 Gene:PBE1 / 837863 AraportID:AT1G13060 Length:298 Species:Arabidopsis thaliana


Alignment Length:217 Identity:66/217 - (30%)
Similarity:100/217 - (46%) Gaps:25/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GTSIVGIIYKDGVILGADTRATEGPIVSD---KNCSKIHHLQDHI-------------------Y 90
            ||:.:..|:|.||::.||:||:.|..:|.   ||.||..|..|.:                   |
plant    57 GTTTLAFIFKGGVMVAADSRASMGGYISVSSLKNSSKNMHPFDIVDFGRNTTSQSVKKIIEINPY 121

  Fly    91 CCG--AGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQG-HIGAALVMGGVD 152
            ..|  ||.|||.:........:..||.|..:||:.|..||.:|...|:.|:| .:....::.|.|
plant   122 MLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWD 186

  Fly   153 TTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGS 217
            .|||.||.:...|...|....::|||:..|..||:.|:|.|:.:|:..:|.|.:|....|.|..|
plant   187 ETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEEASELARRSIYHATFRDGAS 251

  Fly   218 GSNIDLCVITAKGAVYLRTDTI 239
            |....:..:..:|...|..|.:
plant   252 GGVASVYHVGPEGWTKLSGDDV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 66/217 (30%)
proteasome_beta_type_7 49..236 CDD:239732 64/211 (30%)
Pr_beta_C 241..274 CDD:289249
PBE1NP_001184978.1 20S_bact_beta 57..276 CDD:163402 66/217 (30%)
proteasome_beta_type_5 58..269 CDD:239730 63/210 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.