DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PBB2

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_198874.1 Gene:PBB2 / 834056 AraportID:AT5G40580 Length:274 Species:Arabidopsis thaliana


Alignment Length:266 Identity:143/266 - (53%)
Similarity:180/266 - (67%) Gaps:17/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RSGFNFINCRRNAELLSKGYEPPKAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHH 84
            :.||:|..|:||..|..||.:.|..:||||:|||:|:||||||||||||||||||:||||.|||:
plant    11 KGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHY 75

  Fly    85 LQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQGHIGAALVMG 149
            :..:|||||||||||||.:|...|::|.|||..|.|...||.|..:|::.||.||||:.||||:|
plant    76 MAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVVTALTLLKKHLFSYQGHVSAALVLG 140

  Fly   150 GVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFND 214
            |||.|||.|:.|||.||.|.:|:|.||||:||||||.|..:|..|..::|.:||.|||.:|:|||
plant   141 GVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYKEGLTRDEGIKLVAEAICSGIFND 205

  Fly   215 LGSGSNIDLCVITAKGAVYLRT------DTIASEKGERLGKYGI-KPNSTMVTSISVLSLQVTDE 272
            ||||||:|:||||.....|||.      .|..|.||     |.. |....::|.|:.|.     |
plant   206 LGSGSNVDICVITKGHKEYLRNYMEPNPRTYVSSKG-----YSFTKKTEVLLTKITPLL-----E 260

  Fly   273 RIYAVD 278
            |:..|:
plant   261 RVEIVE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 120/198 (61%)
proteasome_beta_type_7 49..236 CDD:239732 117/186 (63%)
Pr_beta_C 241..274 CDD:289249 9/33 (27%)
PBB2NP_198874.1 proteasome_beta_type_7 40..228 CDD:239732 118/187 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D977476at2759
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 1 1.000 - - mtm1211
orthoMCL 1 0.900 - - OOG6_101382
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1020
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.