DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PBB1

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_566818.1 Gene:PBB1 / 822364 AraportID:AT3G27430 Length:273 Species:Arabidopsis thaliana


Alignment Length:261 Identity:139/261 - (53%)
Similarity:180/261 - (68%) Gaps:14/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RSGFNFINCRRNAELLSKGYEPPKAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHH 84
            :.||:|..|:||..|..||.:.|..:||||:|||:|:||||||||||||||||||:||||.|||:
plant    11 KGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHY 75

  Fly    85 LQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQGHIGAALVMG 149
            :..:|||||||||||||.:|...|::|.|||..|.|...|:.|..:|::.||.||||:.||||:|
plant    76 MAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVITALTLLKKHLFSYQGHVSAALVLG 140

  Fly   150 GVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFND 214
            |||.|||.|:.|||.||.|.:|:|.||||:||||||.|..:|..|..::|.:||.|:|.:|:|||
plant   141 GVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYKEGLTRDEGIKLVAESICSGIFND 205

  Fly   215 LGSGSNIDLCVITAKGAVYLRT------DTIASEKGERLGKYGI-KPNSTMVTSISVL--SLQVT 270
            ||||||:|:||||.....|||.      .|..|.||     |.. |....::|.|:.|  .:::|
plant   206 LGSGSNVDICVITKGNKEYLRNYMEPNPRTYVSSKG-----YSFTKKTEVLLTKITPLLERVEIT 265

  Fly   271 D 271
            :
plant   266 E 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 118/198 (60%)
proteasome_beta_type_7 49..236 CDD:239732 115/186 (62%)
Pr_beta_C 241..274 CDD:289249 9/34 (26%)
PBB1NP_566818.1 proteasome_beta_type_7 40..228 CDD:239732 116/187 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D977476at2759
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 1 1.000 - - mtm1211
orthoMCL 1 0.900 - - OOG6_101382
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1020
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.