DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and psmb13a

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_571752.2 Gene:psmb13a / 64280 ZFINID:ZDB-GENE-001208-2 Length:281 Species:Danio rerio


Alignment Length:264 Identity:131/264 - (49%)
Similarity:175/264 - (66%) Gaps:8/264 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GFNFINCRRNAELLSKGYE-----PPKAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSK 81
            ||||.|..||. :|..|.|     ||||:||||:|.|:::||||:||||||||...:|:||.|:|
Zfish    14 GFNFENATRNI-VLENGAEEGKIKPPKALKTGTTIAGVVFKDGVVLGADTRATSDEVVADKMCAK 77

  Fly    82 IHHLQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQGHIGAAL 146
            ||::..:|||||||||||||..|...|:.|.:..:|:.|...||.|..:::..||||.|.|||.|
Zfish    78 IHYIAPNIYCCGAGTAADTEKTTDMLSSNLTIFSMNSGRNPRVVMAVNIIQDMLFRYHGMIGANL 142

  Fly   147 VMGGVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGV 211
            ::||||.||..||.:.|.||.||:||.|||||.||||.:||..:|.::||||.|.||.:||.||:
Zfish   143 ILGGVDCTGSHLYTVGPYGSMDKVPYLAMGSGDLAAMGILEDRFKVNMDLEQAKALVSDAIQAGI 207

  Fly   212 FNDLGSGSNIDLCVITAKGAVYLRTDTIASEKGERLGKYGIKPNST--MVTSISVLSLQVTDERI 274
            ..|||||:||||||||.:|..|:|....:....:|..||..|..:|  :..:::.|.|.:..|.:
Zfish   208 MCDLGSGNNIDLCVITKEGVDYIRPHKESPYNYKRQAKYKYKSGTTPILTKTVNKLELDLVQETV 272

  Fly   275 YAVD 278
            ..::
Zfish   273 QMME 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 107/192 (56%)
proteasome_beta_type_7 49..236 CDD:239732 105/186 (56%)
Pr_beta_C 241..274 CDD:289249 8/34 (24%)
psmb13aNP_571752.2 proteasome_beta_type_7 45..233 CDD:239732 106/187 (57%)
Pr_beta_C 241..272 CDD:315191 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1020
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.