DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PSMB10

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_002792.1 Gene:PSMB10 / 5699 HGNCID:9538 Length:273 Species:Homo sapiens


Alignment Length:263 Identity:129/263 - (49%)
Similarity:187/263 - (71%) Gaps:4/263 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RSGFNFINCRRNAEL--LSKGYEPPKAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKI 82
            |.||:|.||:|||.|  :..|.:.|.|.||||:|.|::::||||||||||||...:|:||:|.||
Human     9 RGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKI 73

  Fly    83 HHLQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQGHIGAALV 147
            |.:...|||||||.|||.||.|...:::::||.|:|.|...|...:.:||:||||||||:||:|:
Human    74 HFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLI 138

  Fly   148 MGGVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVF 212
            :||||.||||||.::|.||..::|:.|:|||..||::|||..::|::.||..:.|:.||::||:.
Human   139 VGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGIL 203

  Fly   213 NDLGSGSNIDLCVITAKGAVYLRTDTIASEKGERLGKYGIKPNSTMVTSISV--LSLQVTDERIY 275
            .|||||.|:|.||||..||..|||.:..:|..:|.|:|...|.:|.|.:.:|  |:|::.:|.:.
Human   204 GDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQ 268

  Fly   276 AVD 278
            |::
Human   269 AME 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 102/192 (53%)
proteasome_beta_type_7 49..236 CDD:239732 99/186 (53%)
Pr_beta_C 241..274 CDD:289249 11/34 (32%)
PSMB10NP_002792.1 proteasome_beta_type_7 40..227 CDD:239732 99/186 (53%)
Pr_beta_C 232..267 CDD:403609 11/34 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101382
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1020
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.