Sequence 1: | NP_572267.1 | Gene: | Prosbeta2R1 / 31511 | FlyBaseID: | FBgn0029812 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002786.2 | Gene: | PSMB3 / 5691 | HGNCID: | 9540 | Length: | 205 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 49/198 - (24%) |
---|---|---|---|
Similarity: | 88/198 - (44%) | Gaps: | 15/198 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 GTSIVGIIYKDGVILGADTR-ATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAEL 111
Fly 112 DLHRLNTERRV-PVVCASMMLRRTLFRYQGHIGAALVMGGVDTTGPQLYCIYPCGSNDKI--PYA 173
Fly 174 A---MGSGTLAAM--SVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKGAVY 233
Fly 234 LRT 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta2R1 | NP_572267.1 | 20S_bact_beta | 48..241 | CDD:163402 | 49/198 (25%) |
proteasome_beta_type_7 | 49..236 | CDD:239732 | 46/195 (24%) | ||
Pr_beta_C | 241..274 | CDD:289249 | |||
PSMB3 | NP_002786.2 | proteasome_beta_type_3 | 6..201 | CDD:239728 | 49/198 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |