DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PSMB1

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_002784.1 Gene:PSMB1 / 5689 HGNCID:9537 Length:241 Species:Homo sapiens


Alignment Length:232 Identity:52/232 - (22%)
Similarity:105/232 - (45%) Gaps:33/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GYEPPKA-----------IKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYC 91
            |.||.:|           :..|.:|:.|..:|..|:.:|||.:||..:..::..|.:.|.|....
Human    16 GMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVI 80

  Fly    92 CGAGTAADTEMITLTTSAELDLHRLN-----TERRVPVVCASMMLRRTLFRYQGHIGAALVMGGV 151
            ..:|...|...:|....|.|.:::.:     |...:..:.::::..|..|.|..:    .::||:
Human    81 GCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVY----NIIGGL 141

  Fly   152 DTTGP-QLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEH--GWK-------PDLDLEQGKQLVREA 206
            |..|. .:|...|.||..:..:.|.||.:.....:|::  |:|       ..|.|::..:||::.
Human   142 DEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDV 206

  Fly   207 ISAGVFNDLGSGSNIDLCVITAKGAVYLRTDTIASEK 243
            ..:....|:.:|..:.:|::|.:|   :|.:|::..|
Human   207 FISAAERDVYTGDALRICIVTKEG---IREETVSLRK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 47/207 (23%)
proteasome_beta_type_7 49..236 CDD:239732 44/201 (22%)
Pr_beta_C 241..274 CDD:289249 1/3 (33%)
PSMB1NP_002784.1 proteasome_beta_type_1 30..241 CDD:239726 48/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.