DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PSMA7

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_002783.1 Gene:PSMA7 / 5688 HGNCID:9536 Length:248 Species:Homo sapiens


Alignment Length:220 Identity:56/220 - (25%)
Similarity:93/220 - (42%) Gaps:27/220 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107
            :|:|.|::.||:..:|.|:||.:.::. ..:..::...||..|.|::....||..||..::....
Human    24 EAVKKGSTAVGVRGRDIVVLGVEKKSV-AKLQDERTVRKICALDDNVCMAFAGLTADARIVINRA 87

  Fly   108 SAELDLHRLNTERRVPV-----VCASMMLRRTLFRYQGHIGAALVMGGVDTTG-PQLYCIYPCGS 166
            ..|...|||..|..|.|     ..||:..|.|....:...|.:.::.|.|..| |:||...|.|:
Human    88 RVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGT 152

  Fly   167 NDKIPYAAMGSGTLAAMSVLEHGW------KPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCV 225
            .......|:|.|..:....||..:      ..||.::...:.:.|.:.:|       |.||:|  
Human   153 YHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSG-------GKNIEL-- 208

  Fly   226 ITAKGAVYLRTDTIASEKGERLGKY 250
                 ||..|..::.....|.:.||
Human   209 -----AVMRRDQSLKILNPEEIEKY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 51/204 (25%)
proteasome_beta_type_7 49..236 CDD:239732 49/198 (25%)
Pr_beta_C 241..274 CDD:289249 3/10 (30%)
PSMA7NP_002783.1 proteasome_alpha_type_7 3..211 CDD:239724 51/201 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.