DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Prosbeta5

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster


Alignment Length:253 Identity:74/253 - (29%)
Similarity:111/253 - (43%) Gaps:20/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PFSARKANTSADFVGLRSGFNFINCRRNAELLSKGYEPP---------KAIKT--------GTSI 51
            |:....|.:|||....:.|. ..|......|.:..:|.|         ...||        ||:.
  Fly    13 PYMRPNAWSSADVEEEQKGL-MCNLANPYTLAAPPFENPLHNLNQIQANGDKTGVKINFDHGTTT 76

  Fly    52 VGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELDLHRL 116
            :|..:|.||:|..|:|||.|..:..::..||..:...:....||.|||........|.|..||.|
  Fly    77 LGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECRLHEL 141

  Fly   117 NTERRVPVVCASMMLRRTLFRYQG-HIGAALVMGGVDTTGPQLYCIYPCGSNDKIPYAAMGSGTL 180
            ..:.|:.|..||.::......|:| .:...:::.|.|..||.||.:...||.......::|||:|
  Fly   142 RNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFSVGSGSL 206

  Fly   181 AAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKGAVYL-RTD 237
            .|..||:.|:..||:.::.::|.|.||....|.|..||..|.:..|...|.|.: .||
  Fly   207 YAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVYHIKEDGWVNISNTD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 62/192 (32%)
proteasome_beta_type_7 49..236 CDD:239732 59/188 (31%)
Pr_beta_C 241..274 CDD:289249
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 67/227 (30%)
proteasome_beta_type_5 74..261 CDD:239730 59/186 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440964
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.