DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and psma6b

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001002589.1 Gene:psma6b / 436862 ZFINID:ZDB-GENE-040718-329 Length:246 Species:Danio rerio


Alignment Length:235 Identity:56/235 - (23%)
Similarity:91/235 - (38%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GLRSGFNFINCRRNAELLS---KGYEPPKAIKT----GTSIVGIIYKDGVILGADTRATEGPIVS 75
            |..:||:     |:..:.|   :.|:...|.|.    |.:.|.:..||..|:....:      |.
Zfish     4 GSSAGFD-----RHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKK------VP 57

  Fly    76 DK--NCSKIHHL---QDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTL 135
            ||  :.|.:.||   .::|.|..:|..||:.........|....:......:||   .|:.:|..
Zfish    58 DKLLDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPV---DMLCKRIA 119

  Fly   136 FRYQGH--------IGAALVMGGVD-TTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWK 191
            ...|.:        :|..:::.|:| ..|||:|...|.|........|.|.....|.|.||...|
Zfish   120 DISQVYTQNAEMRPLGCCMIVIGLDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVK 184

  Fly   192 PDLD--LEQGKQLVREAISAGVFNDLGSGSNIDLCVITAK 229
            ..||  .||..:.....::..:..|. ..|.:::.||||:
Zfish   185 KKLDWTFEQAVETAITCLTTVLSIDF-KPSELEIGVITAE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 48/198 (24%)
proteasome_beta_type_7 49..236 CDD:239732 47/197 (24%)
Pr_beta_C 241..274 CDD:289249
psma6bNP_001002589.1 PRE1 7..245 CDD:223711 55/232 (24%)
proteasome_alpha_type_6 8..220 CDD:239723 51/226 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.