DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and psmb10

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio


Alignment Length:276 Identity:145/276 - (52%)
Similarity:191/276 - (69%) Gaps:8/276 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NTSADFVGLRSGFNFINCRRN----AELLSKGYEPPKAIKTGTSIVGIIYKDGVILGADTRATEG 71
            |||..  .|..||:|.|.|||    |.|..|||..|.|.||||:|.|:::|||||||||||||:.
Zfish     3 NTSTK--TLTGGFSFENTRRNAVLEANLSEKGYSAPNARKTGTTIAGLVFKDGVILGADTRATDD 65

  Fly    72 PIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLF 136
            .:|:||||.|||::..:|||||||.|||.|:.|...|:.::||.|:|.|...|...:..|::.||
Zfish    66 MVVADKNCMKIHYIAPNIYCCGAGVAADAEVTTQMMSSNVELHSLSTGRPPLVAMVTRQLKQMLF 130

  Fly   137 RYQGHIGAALVMGGVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQ 201
            |||||||::|::||||..|.|||.:||.||.||:|:..||||..:|:||.|..:||:::||:.||
Zfish   131 RYQGHIGSSLIVGGVDVNGAQLYSVYPHGSYDKLPFLTMGSGAASAISVFEDRYKPNMELEEAKQ 195

  Fly   202 LVREAISAGVFNDLGSGSNIDLCVITAKGAVYLRTDTIASEKGERLGKYGIKPNSTMVTS--ISV 264
            |||:||:||:|.|||||||:||||||.|...||||......|.:|.|.|..||.:|.|.|  ::.
Zfish   196 LVRDAITAGIFCDLGSGSNVDLCVITDKKVDYLRTYDQPVHKNQRGGTYRYKPGTTAVLSKTVTP 260

  Fly   265 LSLQVTDERIYAVDDQ 280
            |:|.|.||.::.:|.:
Zfish   261 LTLDVVDESVHVMDTE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 110/192 (57%)
proteasome_beta_type_7 49..236 CDD:239732 107/186 (58%)
Pr_beta_C 241..274 CDD:289249 14/34 (41%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 107/183 (58%)
proteasome_beta_type_7 43..231 CDD:239732 108/187 (58%)
Pr_beta_C 237..270 CDD:289249 14/32 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101382
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1020
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.