DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Prosbeta3

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster


Alignment Length:190 Identity:41/190 - (21%)
Similarity:76/190 - (40%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GTSIVGIIYKDGVILGADTR-ATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAEL 111
            |..:|.:..||.|.:..|.| ..:...:| .:..|:.|:...::....|...|...:........
  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTIS-TDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRK 71

  Fly   112 DLHRLNTERRV-PVVCASMMLRRTLFRYQGHIGAAL---VMGGVDTTGPQLYCIYPCGSN----D 168
            :|:.....|.: |...::||   :.|.|:...|...   |:.|:|   |:....:.|..:    .
  Fly    72 NLYETRENREMCPKPFSAMM---SSFLYEHRFGPYFIEPVVAGLD---PKTMEPFICNMDLIGCP 130

  Fly   169 KIPYAAMGSGTLAAM--SVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVI 226
            ..|...:.:||.|..  .:.|..|||||:.:|..:::.::|......|..||....:.:|
  Fly   131 NAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYII 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 41/190 (22%)
proteasome_beta_type_7 49..236 CDD:239732 40/189 (21%)
Pr_beta_C 241..274 CDD:289249
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 41/190 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.