Sequence 1: | NP_572267.1 | Gene: | Prosbeta2R1 / 31511 | FlyBaseID: | FBgn0029812 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_991271.1 | Gene: | psma5 / 403011 | ZFINID: | ZDB-GENE-040625-96 | Length: | 241 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 51/202 - (25%) |
---|---|---|---|
Similarity: | 86/202 - (42%) | Gaps: | 28/202 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107
Fly 108 SAELDLHRLNTERRVPVVCASMMLRRTLFRY----------QGHIGAALVMGGVDTTGPQLYCIY 162
Fly 163 PCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQG--------KQLVREAISAGVFNDLGSGS 219
Fly 220 NIDLCVI 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta2R1 | NP_572267.1 | 20S_bact_beta | 48..241 | CDD:163402 | 48/197 (24%) |
proteasome_beta_type_7 | 49..236 | CDD:239732 | 47/196 (24%) | ||
Pr_beta_C | 241..274 | CDD:289249 | |||
psma5 | NP_991271.1 | proteasome_alpha_type_5 | 8..220 | CDD:239722 | 51/200 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |