DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:215 Identity:56/215 - (26%)
Similarity:97/215 - (45%) Gaps:28/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELD 112
            |.|||.|...|..::.||||.:.|..:..:..||:..|........||..|||  ::||.|.::.
  Fly    29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADT--LSLTGSIKVR 91

  Fly   113 LH-------RLNTERRVPVVCASMMLRRTLFRYQGHIGAALVMGGVDTTGP-QLYCIYPCGSNDK 169
            :.       |..|...|..:.:..|..|..|.|.    .:.::.|:|..|. .:|...|.|..:|
  Fly    92 MQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPYY----VSNILAGIDNEGKGVVYSYDPIGHCEK 152

  Fly   170 IPYAAMGSGTLAAMSVLEH--GWKPDLDLEQGK--QLVRE---AISAGVF-----NDLGSGSNID 222
            ..|.|.|:.......||::  |.| :::||...  :|.:|   ::::..|     .|:.:|.::.
  Fly   153 ATYRAGGTAGTLLQPVLDNQIGHK-NMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVL 216

  Fly   223 LCVITAKGAVYLRTDTIASE 242
            :.:|| |..:.:||.|:..:
  Fly   217 INIIT-KDGIEVRTLTLRQD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 56/212 (26%)
proteasome_beta_type_7 49..236 CDD:239732 52/206 (25%)
Pr_beta_C 241..274 CDD:289249 0/2 (0%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 56/213 (26%)
PRE1 24..225 CDD:223711 53/203 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441192
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.