DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Prosalpha5

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster


Alignment Length:214 Identity:52/214 - (24%)
Similarity:95/214 - (44%) Gaps:30/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107
            :|||.|::.:||...:||:|..:.|.| .|::......||..:..||.|..:|..||...:....
  Fly    29 EAIKLGSTAIGICTPEGVVLAVEKRIT-SPLMVPSTVEKIVEVDKHIGCATSGLMADARTLIERA 92

  Fly   108 SAELDLHRLNTERRVPV-VCASMMLRRTL-FRYQGH----------IGAALVMGGVDTTGPQLYC 160
            ..|...|......|:.: .||..:....: |...|.          .|.|::..|::...|||:.
  Fly    93 RVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEAGQPQLWH 157

  Fly   161 IYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQG--------KQLVREAISAGVFNDLGS 217
            :.|.|:..:....|:|||:..|...|:..::|||.|::.        ||::.|.:::        
  Fly   158 MDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVMEEKLNS-------- 214

  Fly   218 GSNIDLCVITAKGAVYLRT 236
             :|:::..:|.:...|:.|
  Fly   215 -TNVEVMTMTKEREFYMFT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 49/209 (23%)
proteasome_beta_type_7 49..236 CDD:239732 47/206 (23%)
Pr_beta_C 241..274 CDD:289249
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 52/214 (24%)
proteasome_alpha_type_5 8..222 CDD:239722 49/202 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440993
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.