DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Psma8

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:218 Identity:55/218 - (25%)
Similarity:90/218 - (41%) Gaps:18/218 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107
            :|:|.|::.|||...:.|:||.:.::. ..:..::...||..|.||:....||..||..::....
  Rat    26 EAVKKGSTAVGIRGTNIVVLGVEKKSV-AKLQDERTVRKICALDDHVCMAFAGLTADARVVISRA 89

  Fly   108 SAELDLHRLNTERRVPVVCASMMLRRTLFRYQGHIG------AALVMGGVDTTGPQLYCIYPCGS 166
            ..|...|:|..|..|.|...:..:.....:|....|      :||::|..|...|:||...|.|:
  Rat    90 RVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDDDGIPRLYQTDPSGT 154

  Fly   167 NDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVI----- 226
            .......|:|.........||..:..|. :....:.::.||.|.:......|.||:|.:|     
  Rat   155 YHAWKANAIGRSAKTVREFLEKNYTEDA-ISNDNEAIKLAIKALLEVVQSGGKNIELAIIRRDQP 218

  Fly   227 ----TAKGAVYLRTDTIASEKGE 245
                :|| .:.|....|..||.|
  Rat   219 LKMFSAK-EIELEVTEIEREKDE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 50/207 (24%)
proteasome_beta_type_7 49..236 CDD:239732 48/201 (24%)
Pr_beta_C 241..274 CDD:289249 3/5 (60%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 51/210 (24%)
proteasome_alpha_type_7 5..213 CDD:239724 47/188 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.