DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:163 Identity:39/163 - (23%)
Similarity:73/163 - (44%) Gaps:4/163 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELDLH 114
            :::||...|.|:|.|||......||..::.:|||.:.|.:.....|.:.|||..|...|..:.|:
  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67

  Fly   115 RLNTERRVPVVCASMMLRRTLFRY---QGHIGAALVMGGVD-TTGPQLYCIYPCGSNDKIPYAAM 175
            ::.....:....::...|:.|..|   :......:.:.|.| ..||:|..|....:...:.||..
  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAGH 132

  Fly   176 GSGTLAAMSVLEHGWKPDLDLEQGKQLVREAIS 208
            |.|.:.|.|:.:..|.|::...:...:.::.|:
  Fly   133 GYGAIFASSIYDRYWHPNITQAEAYDVFKKCIA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 39/163 (24%)
proteasome_beta_type_7 49..236 CDD:239732 39/163 (24%)
Pr_beta_C 241..274 CDD:289249
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 39/163 (24%)
proteasome_beta_type_2 1..192 CDD:239727 39/163 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441139
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.