DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and psma4

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_999862.1 Gene:psma4 / 326687 ZFINID:ZDB-GENE-040426-1932 Length:261 Species:Danio rerio


Alignment Length:265 Identity:56/265 - (21%)
Similarity:112/265 - (42%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107
            :||....:.:||:..|||:|.|:.|.....:.......||:.|.:.:.|..||..:|..:  ||.
Zfish    26 EAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANV--LTN 88

  Fly   108 SAELDLHRLNTERRVPVVCASMM-----LRRTLFRYQGH--IGAALVMGGVDT-TGPQLYCIYPC 164
            ...|...|...:.:.|:.|..::     :::...::.|.  .|.:|:..|.|. .|.|||...|.
Zfish    89 ELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYMGWDKHYGFQLYQSDPS 153

  Fly   165 GSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAG--VFNDLGSGSNIDLCVIT 227
            |:........:|:.:.||:|:|:.      |.::|:..:..|::..  |.|     ..:|:..::
Zfish   154 GNYGGWKATCIGNNSAAAVSMLKQ------DYKEGEMTLSAALALAVKVLN-----KTMDVSKLS 207

  Fly   228 AKGAVYLRTDTIASEKGERLGKYGIKPNSTMVTSISVLSLQVTDERIYAVDDQQPGTSGVQLDSQ 292
            |:   .:...|:..|.|:              |.|.||..:..:|.|...:.::......:.:.:
Zfish   208 AE---KVEIATLTRENGK--------------TKIKVLKQKEVEELIKKHEAEEAKAEKDKKEKE 255

  Fly   293 QADEE 297
            |.:::
Zfish   256 QKEKD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 45/202 (22%)
proteasome_beta_type_7 49..236 CDD:239732 44/196 (22%)
Pr_beta_C 241..274 CDD:289249 7/32 (22%)
psma4NP_999862.1 PTZ00246 1..237 CDD:173491 54/240 (23%)
proteasome_alpha_type_4 3..216 CDD:239721 46/205 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.