DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:205 Identity:53/205 - (25%)
Similarity:92/205 - (44%) Gaps:15/205 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LLSKGYEPPK-AIKT-------------GTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHH 84
            :::..||.|: ::|.             ||:.||.:|:.|:||..|:|||.|.::..::..|:..
  Fly    43 IMAPPYENPRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQ 107

  Fly    85 LQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQG-HIGAALVM 148
            :..:|....||.|||........:.|..||.|..:.|:||..|:..:......|:| .:...:::
  Fly   108 VNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMML 172

  Fly   149 GGVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFN 213
            .|....||.|..:...|........|:|||...|:.:|:..::.||...:...|...|:......
  Fly   173 AGWSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMT 237

  Fly   214 DLGSGSNIDL 223
            |:.||..:.|
  Fly   238 DIFSGGVVRL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 49/177 (28%)
proteasome_beta_type_7 49..236 CDD:239732 48/176 (27%)
Pr_beta_C 241..274 CDD:289249
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 53/202 (26%)
proteasome_beta_type_5 72..259 CDD:239730 48/176 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440970
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.