DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Psma6

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_058979.1 Gene:Psma6 / 29673 RGDID:61849 Length:246 Species:Rattus norvegicus


Alignment Length:235 Identity:53/235 - (22%)
Similarity:88/235 - (37%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GLRSGFNFINCRRNAELLS---KGYEPPKAIKT----GTSIVGIIYKDGVILGADTRATEGPIVS 75
            |..:||:     |:..:.|   :.|:...|.|.    |.:.|.:..||..::....:      |.
  Rat     4 GSSAGFD-----RHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKK------VP 57

  Fly    76 DK--NCSKIHHL---QDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTL 135
            ||  :.|.:.||   .::|.|...|..||:.........|....:......:||   .|:.:|..
  Rat    58 DKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPV---DMLCKRIA 119

  Fly   136 FRYQGH--------IGAALVMGGVD-TTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWK 191
            ...|.:        :|..:::.|:| ..|||:|...|.|........|.|.....:.|.||...|
  Rat   120 DISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVK 184

  Fly   192 PDLD--LEQGKQLVREAISAGVFNDLGSGSNIDLCVITAK 229
            ...|  .||..:.....:|..:..|. ..|.|::.|:|.:
  Rat   185 KKFDWTFEQTVETAITCLSTVLSIDF-KPSEIEVGVVTVE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 45/198 (23%)
proteasome_beta_type_7 49..236 CDD:239732 44/197 (22%)
Pr_beta_C 241..274 CDD:289249
Psma6NP_058979.1 proteasome_alpha_type_6 8..220 CDD:239723 50/226 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.