DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Psmb10

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001020808.1 Gene:Psmb10 / 291983 RGDID:1307428 Length:273 Species:Rattus norvegicus


Alignment Length:263 Identity:126/263 - (47%)
Similarity:184/263 - (69%) Gaps:4/263 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RSGFNFINCRRNAEL--LSKGYEPPKAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKI 82
            |.||:|.||:|||.|  :..|...|.|.||||:|.|::::||||||||||||...:|:||:|.||
  Rat     9 RGGFSFENCQRNASLEHVLPGLRVPLARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKI 73

  Fly    83 HHLQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQGHIGAALV 147
            |.:...|||||||.||||||.|...:::::||.|:|.|...|...:.:||:||||||||:||:|:
  Rat    74 HFIAPKIYCCGAGVAADTEMTTRMAASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLI 138

  Fly   148 MGGVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVF 212
            :||||..|||||.::|.||..::|:.|:|||..||:::||..::|::.||..::|:.|||:||:.
  Rat   139 VGGVDLNGPQLYSVHPHGSYSRLPFTALGSGQDAAVALLEDRFQPNMTLEAAQELLVEAITAGIL 203

  Fly   213 NDLGSGSNIDLCVITAKGAVYLRTDTIASEKGERLGKYGIKPNSTMVTS--ISVLSLQVTDERIY 275
            .|||||.::|.|||||.||...|..:...|..:|.|:|...|.:|.|.:  :..|:|::.:|.:.
  Rat   204 GDLGSGGSVDACVITAGGAKLQRALSSPIEPVQRAGQYRFAPGTTPVQTQEVRALTLELLEETVQ 268

  Fly   276 AVD 278
            |::
  Rat   269 AME 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 100/192 (52%)
proteasome_beta_type_7 49..236 CDD:239732 98/186 (53%)
Pr_beta_C 241..274 CDD:289249 10/34 (29%)
Psmb10NP_001020808.1 proteasome_beta_type_7 40..226 CDD:239732 98/185 (53%)
Pr_beta_C 233..267 CDD:403609 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101382
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1020
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.