DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Psmb8

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_542945.2 Gene:Psmb8 / 24968 RGDID:3426 Length:276 Species:Rattus norvegicus


Alignment Length:254 Identity:63/254 - (24%)
Similarity:111/254 - (43%) Gaps:28/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GLRS--GFNFINCRRNAELLSKGYEPPKAIKT---------------GTSIVGIIYKDGVILGAD 65
            ||||  |....:.:.....|.:|.:|.:.:::               ||:.:...::.|||:..|
  Rat    25 GLRSDPGHYSFSVQAPELALPRGMQPTEFLRSFGDDQERKVQIEMAHGTTTLAFKFQHGVIVAVD 89

  Fly    66 TRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMM 130
            :||:.|..::....:|:..:..::....:|.|||.:......:.|..|:.|....|:.|..||.:
  Rat    90 SRASAGSYIATIRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKL 154

  Fly   131 LRRTLFRYQGHIGAALVMG----GVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWK 191
            |...:.:|:   |..|.||    |.|..||.||.:...|:.......:.|||...|..|::.|::
  Rat   155 LSNMMLQYR---GMGLSMGSMICGWDKKGPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYR 216

  Fly   192 PDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKGAVYLRTDTIASEKGERLGKY 250
            .||..|:...|.|.||......|..||..:::..:...|.|.:.:..::    :.|.||
  Rat   217 QDLSPEEAYDLARRAIVYATHRDSYSGGVVNMYHMKKDGWVKVESTDVS----DLLHKY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 52/196 (27%)
proteasome_beta_type_7 49..236 CDD:239732 51/190 (27%)
Pr_beta_C 241..274 CDD:289249 3/10 (30%)
Psmb8NP_542945.2 PTZ00488 40..271 CDD:185666 56/237 (24%)
proteasome_beta_type_5 73..260 CDD:239730 51/189 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.