DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and Psmb8

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_034854.2 Gene:Psmb8 / 16913 MGIID:1346527 Length:276 Species:Mus musculus


Alignment Length:236 Identity:62/236 - (26%)
Similarity:105/236 - (44%) Gaps:26/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSKGYEPPKAIKT---------------GTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHH 84
            |.:|.:|...:::               ||:.:...::.|||:..|:|||.|..:|....:|:..
Mouse    44 LPRGMQPTAFLRSFGGDQERNVQIEMAHGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIE 108

  Fly    85 LQDHIYCCGAGTAADTEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQGHIGAALVMG 149
            :..::....:|.|||.:......:.|..|:.|....|:.|..||.:|...:.:|:   |..|.||
Mouse   109 INPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYR---GMGLSMG 170

  Fly   150 ----GVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAG 210
                |.|..||.||.:...|:.......:.|||...|..|::.|::.||..|:...|.|.||:..
Mouse   171 SMICGWDKKGPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLGRRAIAYA 235

  Fly   211 VFNDLGSGSNIDLCVITAKGAVYLRTDTIASEKGERLGKYG 251
            ...|..||..:::..:...|.|.:.    :|:..:.|.|||
Mouse   236 THRDNYSGGVVNMYHMKEDGWVKVE----SSDVSDLLYKYG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 54/196 (28%)
proteasome_beta_type_7 49..236 CDD:239732 53/190 (28%)
Pr_beta_C 241..274 CDD:289249 5/11 (45%)
Psmb8NP_034854.2 PTZ00488 40..271 CDD:185666 59/233 (25%)
proteasome_beta_type_5 73..260 CDD:239730 53/189 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.