DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R1 and PSMB11

DIOPT Version :9

Sequence 1:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001093250.1 Gene:PSMB11 / 122706 HGNCID:31963 Length:300 Species:Homo sapiens


Alignment Length:270 Identity:64/270 - (23%)
Similarity:118/270 - (43%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAELD 112
            ||:.:...::.|||..||||::.|..|:.....|:..:..|:....:||:||..........||.
Human    49 GTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELR 113

  Fly   113 LHRLNTERRVPVVCASMMLRRTLFRYQG-HIGAALVMGGVDTTGPQLYCIYPCGSNDKIPYAAMG 176
            |..|...:...|..|:.:|...:.:|:| .:..|..:.|.|.:||:|:.:|..|:..:....::|
Human   114 LRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVG 178

  Fly   177 SGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKG----------A 231
            ||:..|..||:.|::.|:..::...|.|.|::.....|..||.::||..:...|          .
Human   179 SGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSDACV 243

  Fly   232 VYLRTDTIASEKGERLGKYGIKPNSTMVTSISVLSLQVTDERIYAVDDQQPG--TSGVQLDSQQA 294
            :|:....:...:.|....:.....:|        :.:..::|..:|.   ||  |.|        
Human   244 LYVELQKLLEPEPEEDASHAHPEPAT--------AHRAAEDRELSVG---PGEVTPG-------- 289

  Fly   295 DEELPEGSQT 304
            |..:|.|::|
Human   290 DSRMPAGTET 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 52/203 (26%)
proteasome_beta_type_7 49..236 CDD:239732 51/197 (26%)
Pr_beta_C 241..274 CDD:289249 2/32 (6%)
PSMB11NP_001093250.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
proteasome_beta_type_5 50..237 CDD:239730 50/186 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..300 12/64 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.